PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.001G052500.1
Common NamePHAVU_001G052500g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family CPP
Protein Properties Length: 712aa    MW: 78413 Da    PI: 6.789
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.001G052500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR48.12.3e-15392430341
                 TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                         +kgC+CkkskC+k+YCeCf+ag++C+  C C+dC N+ e
  Phvul.001G052500.1 392 CKGCRCKKSKCIKLYCECFNAGVYCNGPCGCQDCLNRPE 430
                         89**********************************876 PP

2TCR46.38.6e-15454491340
                 TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                         k+gCnCk+s ClkkYCeC++a++ Cs+ C C++CkN+ 
  Phvul.001G052500.1 454 KRGCNCKRSTCLKKYCECYQAKVGCSSGCGCQGCKNSY 491
                         78**********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011147.0E-13390431IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163427.987391492IPR005172CRC domain
PfamPF036383.8E-11393428IPR005172CRC domain
SMARTSM011142.1E-15452493IPR033467Tesmin/TSO1-like CXC domain
PfamPF036384.2E-11454490IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 712 aa     Download sequence    Send to blast
MDSPEPFKNN NNSPDSPQEE SPFCRYVSSL SPINIKASHS TRSFVGLSSP PLVFKSPRIS  60
HRATQFMQRS QGNESVSEVR SQSENGGNIL GEAFGYYLKS DSHQPLPERF ITDTQKVFDP  120
KNDANMQHYG GHFSIYKYLA DPGDIDQMYS ADQDVEQQST DAAETSLSYP TQSNILNIGR  180
KEGLGDKAEE SLPLSEDSNK VHQQMPVSGE EPKRMEREQS DVKNRYSHDP LLPQATLKSN  240
DVGRRRLQFE EGASSALESN KSREKLNATS SLYPQQGCGN LPLPGSKPSG IGLHLNSIVN  300
AMPTNEAATT GVRLPDTSPR MKSTSSERLQ RREIIKGSML SCNVNAESSV DTRTESHEID  360
ATDAGNSEEF NKSPSPCKKK KKTSVAGSQD GCKGCRCKKS KCIKLYCECF NAGVYCNGPC  420
GCQDCLNRPE YKDTVMESRQ QIESRNTENS ARLKRGCNCK RSTCLKKYCE CYQAKVGCSS  480
GCGCQGCKNS YGKIEDYVAV QHTWNIETMS GNNQEMVASE TDYDLRRLSP ITPSLQCYDQ  540
GKEAAKSRVV NMFASCSNNT QSSEGDETVV TEMLRNDPYD SGIECNNDML LQDTLPSNPP  600
FSYAANRWKT VSPSPFSREP IRSDCTVFNM IVHEMHEAST LMTSVEVNSP SQKRVSPPQS  660
GLVSGGLRGG RRIILQSVPS FPPLSSCVDS KSNNNEDLGN SQSKDPHSPS R*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007161225.10.0hypothetical protein PHAVU_001G052500g
TrEMBLV7CSX60.0V7CSX6_PHAVU; Uncharacterized protein
STRINGGLYMA17G31399.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85652841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.16e-26TESMIN/TSO1-like CXC 2